<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+LPV 22
2 None 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K43R, I62V, L63P, V77I, I93L  
>RG28049w31| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T215S K103N   E6D, V35T, E40D, V60I, A98S, K102KR, K122E, G196E, I202IV, E248D, Q278H, I293V, I326M, Y342F, T377V, T386I, K390R  
>RG28049w31| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDLEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLWRWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLMAEIQKQGQGQWTYQIFQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIAVESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008