<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P159 P159-32 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   D121Y, K122E, I135T, L210F, R211K  
>P159-32| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLW
>P159-32| E01 | codons 1-229 | clone E01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLW
>P159-32| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YRYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLW
>P159-32| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPSLW
>P159-32| E05 | codons 1-229 | clone E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPRPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGSTTPDKKHQKEPPFLW
>P159-32| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLW
>P159-32| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKKGKISKIGPENPYNTPV
FAIKKKDSTKWRRLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, G16E, W42Y, I62V, L63P, V77I, I93L  
>P159-32| E03 | codons 1-99 | clone E03
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEVCGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| E01 | codons 1-99 | clone E01
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| E02 | codons 1-99 | clone E02
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| E07 | codons 1-99 | clone E07
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEVCGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| E04 | codons 1-99 | clone E04
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| E05 | codons 1-99 | clone E05
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P159-32| codons 1-99
PQITLWQRPLVPIRIEGQLKEALLDTGADDTVLEEMNLPGRYKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005