<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+LPV 16
2 None 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5LF, T12S, I15V, L19I, M36I, R41K, L63V, H69K, T74TS, L89M, I93L  
>RG19024w20| codons 1-99
PQITFWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48E, V60I, K122E, D123G, K166R, K173A, Q174R, D177E, I178M, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, K311R, Q334D, G335D, R356K, M357MR, R358RK, G359T, T377Q, K390R  
>RG19024w20| codons 1-397
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRARNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKRKTA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKET

References
Author Title Citation
Riddler, SA Class-sparing regimens for initial treatment of HIV-1 infection. N Engl J Med, 2008