<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P158 P158-56 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ EFV 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, K103N, G190S   V35T, T39A, S48E, I135R, S162A, T200A  
>P158-56| A06 | codons 1-229 | clone A06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGRIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKNFRKYTASTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A07 | codons 1-229 | clone A07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A08 | codons 1-229 | clone A08
PISPIETVPVKLKPGMDGPKAKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKNHQKEPPFLW
>P158-56| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A01 | codons 1-229 | clone A01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTMPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPSLW
>P158-56| A02 | codons 1-229 | clone A02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A03 | codons 1-229 | clone A03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIGELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A05 | codons 1-229 | clone A05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTPFTIPSRNNETPGIRYQYNVPPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-56| A04 | codons 1-229 | clone A04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKHNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18L, L63P  
>P158-56| codons 1-99
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A07 | codons 1-99 | clone A07
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A02 | codons 1-99 | clone A02
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A03 | codons 1-99 | clone A03
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGRTLNF
>P158-56| A04 | codons 1-99 | clone A04
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A06 | codons 1-99 | clone A06
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A08 | codons 1-99 | clone A08
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A01 | codons 1-99 | clone A01
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-56| A05 | codons 1-99 | clone A05
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005