<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P158 P158-19 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ EFV 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190S   V35T, T39A, S48E, S162A, T200A  
>P158-19| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F05 | codons 1-229 | clone F05
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEREGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F08 | codons 1-229 | clone F08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F07 | codons 1-229 | clone F07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEAQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F03 | codons 1-229 | clone F03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKMEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F02 | codons 1-229 | clone F02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P158-19| F06 | codons 1-229 | clone F06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18L, L63P  
>P158-19| F05 | codons 1-99 | clone F05
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNPLTQIGCTLNF
>P158-19| F06 | codons 1-99 | clone F06
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-19| F02 | codons 1-99 | clone F02
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-19| F07 | codons 1-99 | clone F07
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-19| F03 | codons 1-99 | clone F03
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-19| codons 1-99
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P158-19| F08 | codons 1-99 | clone F08
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005