<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, M36I, N37D, I62V, L63S, I64V, E65D  
>HM091| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QVSVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, I135R, E169D, V179I, G196E, I202V, I293V, V317T, M357V, V365I, T386I, K390R, A400T, T403M, V435G, N447S, H483Y, K512Q, S519N, K527Q, A554S, K558R  
>HM091| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGTYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDIKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIGGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRRVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V32I, M50L, L101I, K111T, T112A, S195T, S230N, L234I, D279G S283G
>HM091| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVIAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTAIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYTAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

References
Author Title Citation
Ng, OT Identification of New CRF51_01B in Singapore using full genome analysis of three HIV type 1 isolates. ARHR, 2011