<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB5-P154 P154-32 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 EFV+3TC+AZT 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, Y188H, G190A   R83K, D123E, G196E, T200A, Q207E, R211K R72G, M164T
>P154-32| D06 | codons 1-229 | clone D06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWGKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSTTKILEPFRKQNPDIVI
YQYMDDLHVASDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLW
>P154-32| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWGKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSTTKILEPFRKQNPDIVI
YQYMDDLHVASDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, P39S, Q61E, L63P, V77I, I93L  
>P154-32| D06 | codons 1-99 | clone D06
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P154-32| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005