<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P6 P6-2 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, V179I, R211K  
>P6-2| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| E10 | codons 1-229 | clone E10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKIPKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLSKWGFTTPGKKHQKEPPFLW
>P6-2| E11 | codons 1-229 | clone E11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKTLEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 068E08 | codons 1-229 | clone 068E08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILGPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPLLW
>P6-2| 068E05 | codons 1-229 | clone 068E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
YQYMDDLCVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 062E07 | codons 1-229 | clone 062E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIGELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 062E09 | codons 1-229 | clone 062E09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 062E05 | codons 1-229 | clone 062E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 068E09 | codons 1-229 | clone 068E09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWKKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| E01 | codons 1-229 | clone E01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| 062E08 | codons 1-229 | clone 062E08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
GKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLLKWGLTTPDKKHQKEPPFLW
>P6-2| E06 | codons 1-229 | clone E06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDSRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSNLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEGKIKALVEICTEMEKEGKISKIGPENPYNTPV
LAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSIDNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-2| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, N37D, I62V, L63P, A71T, I72E, V77I, I93L  
>P6-2| E02 | codons 1-99 | clone E02
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E03 | codons 1-99 | clone E03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 062E09 | codons 1-99 | clone 062E09
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 062E08 | codons 1-99 | clone 062E08
PQITLWPRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 068E05 | codons 1-99 | clone 068E05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 068E08 | codons 1-99 | clone 068E08
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 062E07 | codons 1-99 | clone 062E07
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 062E05 | codons 1-99 | clone 062E05
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E10 | codons 1-99 | clone E10
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E01 | codons 1-99 | clone E01
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| 068E09 | codons 1-99 | clone 068E09
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E04 | codons 1-99 | clone E04
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E06 | codons 1-99 | clone E06
PQITLWQRPLVTIRIGGQIKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTKGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E07 | codons 1-99 | clone E07
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| E11 | codons 1-99 | clone E11
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLSGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-2| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005