<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P6 P6-0 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, T139A  
>P6-0| A05b | codons 1-229 | clone A05b
PISPIETVPVKLKPGMDGPKVEQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P6-0| A03a | codons 1-229 | clone A03a
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P6-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, K20R, E35D, N37D, I62V, L63P, I72E, I93L  
>P6-0| A05b | codons 1-99 | clone A05b
PQITLWQRPLVTIRIGGQLREALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTEGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P6-0| A03a | codons 1-99 | clone A03a
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P6-0| codons 1-99
PQITLWQRPLVTIRIGGQLREALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005