<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, I15V, M36I, N37K, R41N, L63I, H69K, L89M, I93L  
>SC53| codons 4-99
TLWQRPLVPIRVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYDQII
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K65E, K66E, K122E, I135K, E169D, K173A, D177E, T200A, Q207E, R211K, V245Q, W252R, I257R G262R
>SC53| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKEEDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSRTVNDRQKLVRK

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V32I, S39C, M50T, L101I, K103R, T112V, T124N, K136Q, V201I, T218I, L234I, I251L, R269K, D278A V281M, D288E
>SC53| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPVIAKEIVACCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILRLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKAKIIKDYGKQMAGADCMASRQDEE

References
Author Title Citation
Graf, T HIV-1 genetic diversity and drug resistance among treatment naive patients from southern Brazil: An association of HIV-1 subtypes with exposure categories. J Clin Virol, 2011