<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P51 P51-0 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       V35I, E40F, K43E, V118I, H208Y, R211K  
>P51-0| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLGEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALIEICTFLEEEGKISKIGPENPYNTPV
LAIKKKNSDKWRKLVDSRELNKRTQDFWEVQLGIPHPAGLKKEKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P51-0| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A03j | codons 1-229 | clone A03j
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEGGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A02q | codons 1-229 | clone A02q
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A07m | codons 1-229 | clone A07m
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A02p | codons 1-229 | clone A02p
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEVGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A06m | codons 1-229 | clone A06m
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGEISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAITIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTRIEELRQYLRKWGFYTPDKKHQKEPPFLW
>P51-0| B05e | codons 1-229 | clone B05e
PISPIETVPVKLKPEMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMGDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A03i | codons 1-229 | clone A03i
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P51-0| A06l | codons 1-229 | clone A06l
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLEIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P51-0| A05k | codons 1-229 | clone A05k
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGSENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A04m | codons 1-229 | clone A04m
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW
>P51-0| A01m | codons 1-229 | clone A01m
PFSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW
>P51-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, N37C, I64V, V77I  
>P51-0| A02q | codons 1-99 | clone A02q
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A03i | codons 1-99 | clone A03i
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A04m | codons 1-99 | clone A04m
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGRKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A07m | codons 1-99 | clone A07m
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMGLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G06 | codons 1-99 | clone G06
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPAPVNIIGRNLLTQIGCTLNF
>P51-0| A03j | codons 1-99 | clone A03j
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKLIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQVGCTLNF
>P51-0| A02p | codons 1-99 | clone A02p
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| B05e | codons 1-99 | clone B05e
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEVCGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A06l | codons 1-99 | clone A06l
PQITLRQRPLVTVRIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G07 | codons 1-99 | clone G07
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMALPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A05k | codons 1-99 | clone A05k
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A06m | codons 1-99 | clone A06m
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G08 | codons 1-99 | clone G08
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G02 | codons 1-99 | clone G02
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G01 | codons 1-99 | clone G01
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G05 | codons 1-99 | clone G05
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G03 | codons 1-99 | clone G03
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| G04 | codons 1-99 | clone G04
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| A01m | codons 1-99 | clone A01m
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIRVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P51-0| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005