<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA
2 3TC|D4T|EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75M, K219E G190A A98G, V108I V35T, T39E, S48T, V60I, T69N, V118I, D121H, K122E, I135T, S162SN, K173T, D177E, I178M, T200A, E203D, E204K, Q207E, F214L, V245Q P1S
>345aRT| codons 1-255
SISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTQNPEMVI
YQYVDDLYVASDLEIGQHRAKIDKLREHLLRWGLFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVN

References
Author Title Citation
Deshpande, A Phylogenetic analysis of HIV-1 reverse transcriptase sequences from 382 patients recruited in JJ Hospital of Mumbai, India, between 2002 and 2008. ARHR, 2009