<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C A98G V35T, T39N, K49KR, V60I, K173A, D177E, T200A, Q207K, R211K K166KM
>303RT| codons 14-243
PGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPIFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIP
SINNETPGIRYQYNVLPQGWKGSPAIFQSSMTMILEPFRAQNPEIVICQYMDDLYVGSDL
EIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQP

References
Author Title Citation
Deshpande, A Phylogenetic analysis of HIV-1 reverse transcriptase sequences from 382 patients recruited in JJ Hospital of Mumbai, India, between 2002 and 2008. ARHR, 2009