<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q K101EQ, G190A A98G K20R, E28EK, V35T, T39D, E44D, S48T, V60I, T69N, D121H, K122E, I135T, K173A, Q174R, I178M, T200A, Q207E, R211RK, V245Q F124FV, L246W
>16RT| codons 1-248
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALTEICDELEKDGKITKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPL
HEDVRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRARNPDMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQWPE

References
Author Title Citation
Deshpande, A Phylogenetic analysis of HIV-1 reverse transcriptase sequences from 382 patients recruited in JJ Hospital of Mumbai, India, between 2002 and 2008. ARHR, 2009