<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat043 in1131 India 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, M36I, R41K, K43R, L63H, H69K, L89M, I93L W42WR
>in1131| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEEINLPGKRRPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E36A, T39E, S48T, K122E, D123S, K173A, D177E, T200A, Q207E, R211K, V245Q P55PT, K73KI, E138EV
>in1131| codons 8-254
VPVKLKPGMDGPKVKQWPLTEEKIKALVAICEEMEKEGKITKIGPENTYNTPVFAIKKKD
STKWRILVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKY
TAFTIPSINNVTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYMDDL
YVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLP
EKDSWTV

References
Author Title Citation
Deshpande, A Drug Resistance Mutations in HIV Type 1 isolates from naive patients eligible for first line antiretroviral therapy in JJ Hospital, Mumbai, India. ARHR, 2011