<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI T12S, I13IV, I15V, G16GE, L19IT, M36I, R41K, K45R, L63ST, H69K, L89I, I93L K70K*
>in1142| codons 1-99
PQITLWQRPLISVKVEGQTKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QITIEICGK*AIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E V35T, T39D, S48T, E53D, V60I, K102KQ, I135R, S162A, K173A, D177E, I178L, T200A, E203ED, Q207E, R211K, V245Q E79E*
>in1142| codons 8-254
VPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPDNPYNTPIFAIKKKD
STKWRKLVDFR*LNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKY
TAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPELEIYQYMDDL
YVGSDLEIGQHRAKIDELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLP
EKDSWTV

References
Author Title Citation
Deshpande, A Drug Resistance Mutations in HIV Type 1 isolates from naive patients eligible for first line antiretroviral therapy in JJ Hospital, Mumbai, India. ARHR, 2011