<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P37 P37-84 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   A98S, I135V, T200A  
>P37-84| G07 | codons 1-229 | clone G07
PISPIETVPVKLEPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
HQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKRQKEPPFLW
>P37-84| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVIVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDSRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIVELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRRHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLEDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P37-84| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I L10V, E35D, M36I, I62V, L63P, H69Q, V77I  
>P37-84| G01 | codons 1-99 | clone G01
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLAQLGCTLNF
>P37-84| G07 | codons 1-99 | clone G07
PQITLWQRPVVTIKVGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G06 | codons 1-99 | clone G06
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G05 | codons 1-99 | clone G05
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G04 | codons 1-99 | clone G04
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G03 | codons 1-99 | clone G03
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAMGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G08 | codons 1-99 | clone G08
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVSIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>P37-84| G02 | codons 1-99 | clone G02
PQITLWQRPVVTIKVGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF
>P37-84| codons 1-99
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005