<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, G190A   E6D, V35T, E36A, T39E, K102KN, K122E, D123N, S162SA, G196R, T200A, Q207E, R211K, V245Q, E248N  
>10ZA_SAVE2341| codons 6-258
DTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPVFAIKK
KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKNNKSVTVLDVGDAYFSVPLDENFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVIYQYVD
DLYVASDLEIRQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQ
LPNKDSWTVNDIQ

References
Author Title Citation
El-Khatib, Z Viremia and drug resistance among HIV-1 patients on antiretroviral treatment: a cross-sectional study in Soweto, South Africa. AIDS, 2010