<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat009 10ZA_SAVE1123 South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75I K103N P225PH V35T, E36A, T39E, S48T, V60L, K122E, D123S, I132L, K173A, D177E, I178L, T200A, Q207D, R211K, V245Q D186N
>10ZA_SAVE1123| codons 6-258
ETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPLFAIKK
KDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFR
KYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVIYQYVD
NLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWTVQPIQ
LPEKDSWTVNDIQ

References
Author Title Citation
El-Khatib, Z Viremia and drug resistance among HIV-1 patients on antiretroviral treatment: a cross-sectional study in Soweto, South Africa. AIDS, 2010