<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P29 P29-0 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V35M, T39A, S68G, I135T, T200E  
>P29-0| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKEDGTKWRKLVDFRELNKRTQGFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPHGWKGSPAIFQSSMTKILEPFRRQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| D02 | codons 1-229 | clone D02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPEDPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| B02 | codons 1-229 | clone B02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGVPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNSETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRRQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| A02 | codons 1-229 | clone A02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFGKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| C02 | codons 1-229 | clone C02
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQGFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAILQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREEIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| F02 | codons 1-229 | clone F02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| H02 | codons 1-229 | clone H02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQEEPPFLW
>P29-0| D04 | codons 1-229 | clone D04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKEKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHKEKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P29-0| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L63P, K70T  
>P29-0| D04 | codons 1-99 | clone D04
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| E02 | codons 1-99 | clone E02
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| F02 | codons 1-99 | clone F02
PQITLWQRPVVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| C02 | codons 1-99 | clone C02
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| H02 | codons 1-99 | clone H02
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLAGPTPVNIIGRNLLTQIGRTLNF
>P29-0| D02 | codons 1-99 | clone D02
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| B02 | codons 1-99 | clone B02
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| A02 | codons 1-99 | clone A02
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| E04 | codons 1-99 | clone E04
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHTAIGTVLVGPTPVNIIGRNLLAQIGCTLNF
>P29-0| G02 | codons 1-99 | clone G02
PQITLWQRPVVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P29-0| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005