<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P26 P26-16 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N, Y188L   D121Y, K122E, E138A, S162C, T200A, E224D  
>P26-16| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P26-16| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPRPAGIKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKRGFYTPDKKHQKDPPFLW
>P26-16| G01 | codons 1-229 | clone G01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-16| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKKTQDFWEVRLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKDPPFLW
>P26-16| G04 | codons 1-229 | clone G04
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVPDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-16| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKKPPFRW
>P26-16| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRIQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIRQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P26-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKDPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, V82A   I15V, E35D, N37D, L63P, H69Q, A71I  
>P26-16| G02 | codons 1-99 | clone G02
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-16| G04 | codons 1-99 | clone G04
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-16| G06 | codons 1-99 | clone G06
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-16| G01 | codons 1-99 | clone G01
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-16| G08 | codons 1-99 | clone G08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P26-16| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMGLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P26-16| G03 | codons 1-99 | clone G03
PQITLWQRPLVTIKVGGQLKEALIDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQVGCTLNF
>P26-16| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKIIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005