<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA
2 3TC+AZT+LPV NA
3 3TC+AZT+LPV+TDF NA
4 AZT+EFV+TDF NA
5 3TC+AZT+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, T69~, Q151M A62V, V75I, F77L, K219Q V106M, Y181C K101N K20R, V35T, T39E, S68G, D121Y, K122E, A158S, K173T, Q174K, D177E, T200A, E203K, Q207E, R211K, F214L, K223E, L228R, V245Q, A272P, K277R, Q278H, T286A, E291A, V292I, I293V  
>ZAP1| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FVIKRKNG~KWRKLIDLRELNKRTQDFWEVQLGIPHPAGLNKKKSMTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRTKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIKELREHLLKWGLTTPDQKHQEEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTAIVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, I93L  
>ZAP1| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Wallis, CL Case report of the rare deletion at codon 69 of reverse transcriptase in a South African HIV-1 subtype C infected patient. Virus Genes, 2010