<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BA4 BA4_v4 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 NFV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IL, N88NS   R41K, I64V, I93IL  
>BA4_v4| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFLKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Atkinson, B Correlation between human immunodeficiency virus genotypic resistance and virologic response in patients receiving nelfinavir monotherapy or nelfinavir with lamivudine and zidovudine. J Infect Dis, 2000