Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| BA2 | BA2_v4 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NFV | 13 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N | W6WC, T12A, I15V, E35D, N37H, R41K, L63P |
| >BA2_v4| codons 1-99 PQITLCQRPLVAIKVGGQLKEALLDTGADNTVLEDMHLPGKWKPKMIGGIGGFIKVRQYD QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Atkinson, B | Correlation between human immunodeficiency virus genotypic resistance and virologic response in patients receiving nelfinavir monotherapy or nelfinavir with lamivudine and zidovudine. | J Infect Dis, 2000 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
