<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BA1 BA1_v3 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  T74P I13V, L19V, L63P  
>BA1_v3| codons 1-99
PQITLWQRPLVTVKIGGQVKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGPVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Atkinson, B Correlation between human immunodeficiency virus genotypic resistance and virologic response in patients receiving nelfinavir monotherapy or nelfinavir with lamivudine and zidovudine. J Infect Dis, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005