<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, Q61H, L63H, H69K, P79A, L89M, I93L  
>IN-NARI-HIVDR-5-015| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
HIHIEICGKKAIGTVLVGATPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39DN, S48T, V60I, D121H, K122E, I135T, S162H, T165I, K173T, D177E, T200A, Q207E, V245Q, A272P, K277R, K281R, E291D, V292I, I293V, P294T, K311R  
>IN-NARI-HIVDR-5-015| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICNEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMIKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTDIVTLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Thorat, SR Surveillance of transmitted HIV type 1 drug resistance among HIV yype 1-positive women attending an antenatal clinic in Kakinada, India. ARHR, 2011