Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| BA4 | BA4 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NFV | 1 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| N88S | I15V, K20KR, M36I, I62V, L63HP, I72V |
| >BA4| codons 1-99 PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD QVHIEICGHKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Atkinson, B | Correlation between human immunodeficiency virus genotypic resistance and virologic response in patients receiving nelfinavir monotherapy or nelfinavir with lamivudine and zidovudine. | J Infect Dis, 2000 |