Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
BA27 | BA27 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | NRTI | NA |
2 | NFV | 16 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
D30N | I13V, E35D, M36MIL, N37S, L63P, I64IV, I93IL |
>BA27| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDLSLPGRWKPKMIGGIGGFIKVRQYD QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF |
References
Author | Title | Citation |
Atkinson, B | Correlation between human immunodeficiency virus genotypic resistance and virologic response in patients receiving nelfinavir monotherapy or nelfinavir with lamivudine and zidovudine. | J Infect Dis, 2000 |
Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |