<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pat026 MD79640 South Africa 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106M   V35T, E36A, T39E, S48T, K103R, K122E, D123S, T139A, K173R, Q174K, D177N, T200E, Q207E, R211K, F214L, V245Q, A272P K30N
>MD79640| codons 26-273
LTEENIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKRKSMTVLDVGDAYFSVPLDESFRKYTAFTIPSINNEAPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRRKNPNIVIYQYMDDLYVGSDLEIGQHREKIEEL
REHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQKLVGKLN
WASQIYPG

References
Author Title Citation
Hoffmann, C Viremia, resuppression, and time to resistance in human immunodeficiency virus (HIV) subtype C during first-line antiretroviral therapy in south Africa. Clin Infect Dis, 2009