<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184V   K103N   I31L, V35T, T39E, S48T, T69TN, A98S, K101Q, D121Y, K122E, D123E, K173I, Q174K, D177E, Q197L, T200A, Q207E, R211K, V245Q, D250E, A272P  
>MD57113| codons 26-273
LTEEKLKALTEICEEMEKEGKITKIGPENPYNTPVFAIKKKDSNKWRKVVDFRELNKRTQ
DFWEVQLGIPHPSGLQKNKSVTVLDVGDAYFSVPLYEEFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYVDDLYVGSDLEIGLHRAKIEEL
REHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKESWTVNDIQKLVGKLN
WASQIYPG

References
Author Title Citation
Hoffmann, C Viremia, resuppression, and time to resistance in human immunodeficiency virus (HIV) subtype C during first-line antiretroviral therapy in south Africa. Clin Infect Dis, 2009