<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7116 CA17591 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 29
2 3TC+AZT+NFV 20
3 3TC+AZT 8
4 3TC+D4T+IDV 131
5 None 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37NS, L63A, I93IL  
>CA17591| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122KE, I135V, T286A, I293V, E297A S268SR
>CA17465| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWARQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005