<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6366 CA17588 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 26
2 3TC+AZT+IDV 39
3 DDI+NFV+NVP 26
4 D4T+DDI+RTV+SQV 44
5 3TC+ABC+EFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, N37S, L63P, A71V, V77I, I93L  
>CA17588| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MIV, T215Y K219Q K103N, Y181C, G190A   V35M, V90I, A98S, K122E, I135T, S162SR, K166R, Q207K, R211Q, D218E, A272P, T286A, I293V, E297N V254VG
>CA17463| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQRSMTRILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRKHLLQWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTGNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTNEAE
LEL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  R263RK E11D, S24N, M50I, I72V, T112V, M154L, T206S, S255SR  
>CA124167| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESLNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNRDIKVVPRKKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009