<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2107 CA17581 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T 26
3 3TC+AZT 21
4 3TC+AZT+RTV 8
5 3TC+AZT+IDV 17
6 3TC+NVP+SQV 17
7 D4T+DDI+NVP 39
8 3TC+NVP+NFV 56
9 D4T+DDI 8
10 DDI 12
11 ABC+D4T+DDI 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, M36L, N37S, I62V, L63Q, I93L  
>CA17581| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYD
QVQIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       K43KE, E44A, V60I, V118I, I142V, D177E, I178M, H208HY, R211D, V245K, A272P, T286A, I293V A299AG
>CA17456| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWDWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005