<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3972 CA17576 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+IDV 104
3 AZT+D4T+SQV 87
4 3TC+AZT+NFV 48
5 3TC+AZT+IDV+RTV 40
6 ABC+APV+D4T 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76LV, L90M L10FI, G73S, L89V I13IV, K20I, E35D, I62V, L63P, A71AV, I93L  
>CA17576| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVVVGPTPVNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y K219N   K101H E40F, K43E, V118I, K122E, S162C, E169D, H208Y, R211K, V245M, Q278QH, I293V  
>CA17451| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE
LELA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009