<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7091 CA17558 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ IDV 173
2 D4T+ DDI+ EFV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, N37D, R41K, I62V, L63P, A71T, I72R, I93L, C95F  
>CA17558| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTRGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q L100I, K103N   K20R, K102R, I135V, I142V, Q174H, V179I, G196E, R211G, F214L, A272S, I293V, E297A M16MIV, V254VG, A299AG
>CA17433| codons 1-303
PISPIETVPVKLKPGVDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLGWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTGNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTAEGE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005