<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7082 CA17546 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 190
2 AZT+D4T NA
3 3TC+AZT+D4T+SQV 5
4 3TC+D4T+SQV 185
5 3TC+D4T 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10LI, K14KR, L19Q, E35D, D60E, Q61E, L63P, A71V, I93L  
>CA17546| codons 1-99
PQITLWQRPIVTIRIGGQQKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYE
EIPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E     K154E, S162A, G196GR, R211K, F214L, A272P, K277R A129AG, I132IR, I142GV, K275KN
>CA17421| codons 1-285
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTGFTRPSINNETPGGRYQYNVLPQGWEGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIRQHRTKIEELRQHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGINVRQLCKLLRG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005