<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7081 CA17545 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 DDI+NVP+RTV+SQV 86
3 ABC+D4T+NFV 17
4 ABC+APV+RTV+D4T 26
5 ABC+APV+RTV+D4T+EFV 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M   R57K, L63Q, I64V  
>CA17545| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFMKVKQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C   K173E, I178L, T200TK, R211K, H221HY, L228LR, P243S, V245Q, A272P, V292VI, S322A, A376S, S379A, T386I, K390R, E399D, A400T, D460N, V467VI, S519N, Q524E, V559I A299AG
>CA17420| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDLVI
CQYMDDLYVGSDLEIGQHRKKIEELRQHLLKWGFTTPDKKYQKEPPFRWMGYELHPDKWT
VQSIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTEEGE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKISTEAIVIWGKIPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005