<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5148 CA17539 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+IDV 43
2 3TC+D4T+DDI+RTV 21
3 3TC+DDI+RTV+SQV 17
4 3TC+DDI+EFV 34
5 ABC+APV+D4T 47
6 3TC+D4T+EFV+NFV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, K20R, E35D, M36I, N37D, D60E, I62V, L63P, A71X, V77I, I93L R8RQ
>CA17539| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGHKXIGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184V, T215F K219W K103N, Y181YC V108VI V35M, K43KE, I135T, E194EK, T200A, I202V, H208HY, R211K, I293V A299AG
>CA17414| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLKIGQHRAKVEELRQYLLKWGFFTPDWKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005