<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1461 CA17537 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 DDI+ AZT 17
3 DDC+ AZT 40
4 SQV+ DDC+ AZT 103
5 3TC+ AZT 14
6 IDV+ D4T+ 3TC 34
7 DDI+ NVP+ D4T 23
8 SQV+ RTV 60
9 NFV+ SQV+ 3TC+ DDI 28
10 ABC+ DDI+ NFV+ SQV 25
11 AZT+ DDI+ EFV 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10F, L33F, F53L, T74P G16A, I62V, L63P, A71V, V77I, I93L  
>CA17537| codons 1-99
PQITLWQRPFVTIKIAGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGLIKVRQYD
QVPIEICGHKVIGPVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75L, K219KN Y181C, G190S   K20R, V21I, V35I, T39A, E40F, K43E, K101Q, V118I, K122E, D177E, I178M, T200A, Q207E, H208Y, R211K, L228H, A272P, K277R, L283I, I293V, E297K K275KN, K281KEGR, L289LR, T290TR
>CA17412| codons 1-297
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVSSDLEIGQHRAKIEELREYLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGINVRQLCRLIRGTKARREVVPLTK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005