<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2197 CA17530 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 112
2 3TC+ AZT+ RTV 39
3 3TC+ D4T+ IDV 100
4 None 5
5 IDV+ D4T+ 3TC+ NVP 43
6 IDV+ D4T+ 3TC+ NVP+ RTV 10
7 D4T+ IDV+ NVP+ RTV+ ABC+ EFV 1
8 D4T+ ABC+ EFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S I15V, Q18H, K20M, M36I, L63P, H69Q, V77I, I85V, I93L  
>CA17530| codons 1-99
PQITLWQRPLVTIKVGGHLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAISTVLIGPTPVNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, K70R, M184MV A62V K103N   A98S, D123E, I135IV, D177E, I178L, G196R, Q207E, R211K, V245K, A272P, K277R, I293V A267AG, A299AG
>CA17405| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIRQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWGSQIYPGIKVRQLCKLLRGTKALTEVVPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005