<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1322 CA17529 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 NRTI 365
3 3TC+AZT+SQV 30
4 3TC+D4T+IDV 40
5 3TC+D4T+IDV+RTV 29
6 None 7
7 D4T+IDV+RTV 9
8 3TC+AZT+EFV 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, R41RK, L63A, V77VI  
>CA17529| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TI     T39A, K122E, I142V, T165I, D177DN, G196E, R211RK, A288S A299AG
>CA17404| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFITPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005