<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7068 CA17523 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 104
2 3TC+AZT+IDV 26
3 ABC+APV+EFV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53L, Q58E L10IM, I15V, K20R, M36I, N37D, L63P, I64V, T74K, I93L L5LR
>CA17523| codons 1-99
PQITRWQRPIVTIKVGGQLREALLDTGADDTVLEEIDLPGRWKPKLIGGIGGLVKVREYD
QIPVEICGHKAIGKVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K103N, Y181C, G190A V179F T39A, K43E, E44A, K101KR, V111I, V118I, K122KE, I135T, D177DE, Q207QE, H208Y, R211K, L228HR, V245M, A272P, K277R  
>CA17397| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIFI
CQYMDDLYVASDLEIGQHRTKIEELREYLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009