<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA637 CA17521 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 3TC+D4T 17
4 3TC+D4T+SQV 22
5 3TC+D4T+IDV 13
6 3TC+AZT+IDV 13
7 3TC+AZT+NFV 13
8 3TC+D4T+RTV+SQV 47
9 3TC+D4T+EFV 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   K20X, E35D, M36I, N37E, I62V, I64V, H69Y  
>CA17521| codons 11-99
VTIKIGGQLXEALLDTGADDTVLEDIELPGRWKPKIIGGIGGFIKVRQYDQVLVEICGYK
AIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005