<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7066 CA17518 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 29
2 3TC+AZT 13
3 3TC+AZT+IDV 22
4 DDI+NFV+NVP 20
5 RTV+SQV 48
6 ABC+D4T+EFV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L24LI A22V, E35D, M36I, R57K, I62V, L63P, A71V, I72V, I93L  
>CA17518| codons 1-99
PQITLWQRPLVTIKIGGQLKEVLIDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVKQYD
QVPIEICGHKVVGTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210LW, T215F   K103N, Y181C V179F K49KR, K82R, A98S, D177E, G196E, Q207K, R211A, H221HY, L228LR, A272P, I293V A299AG
>CA17393| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIFI
CQYMDDLYVGSDLEIEQHRTKIEELRKHLWAWGFFTPDKKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEGE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005