<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7065 CA17516 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+SQV 22
2 AZT+IDV 35
3 3TC+D4T+IDV 182

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, L90M G73GA L10I, R41K, K55R, D60E, Q61E, I62V, L63P, A71T, I72R, V77I, I85IV, I93L  
>CA17516| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIRVRQYE
EVPIEICGHKTRATVLIGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009