<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AS1-0703B7 AS1-0703B7 Botswana 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, K20R, M36I, P39S, R41K, D60E, I62V, L63H, H69K, V82I, L89M, I93L  
>AS1-0703B7| codons 1-99
PQITLWQRPLVSIKVEGQIREALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYE
QVHIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Wright, JK Influence of Gag-protease-mediated replication capacity on disease progression in individuals recently infected with HIV-1 subtype C. J Virol, 2011