<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1271 CA17509 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 D4T 100
4 3TC+AZT 35
5 3TC+AZT+IDV 22
6 3TC+D4T+IDV 13
7 3TC+D4T+IDV+NVP 4
8 3TC+RTV+SQV 77
9 3TC+DDI+EFV+RTV+SQV+Unknown 27
10 DDI+EFV+Unknown 1
11 None 5
12 3TC+RTV+SQV 10
13 Unknown 68
14 ABC+APV+DDC+LPV+TDF 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90LM G73GS L10LI, K20KR, E35D, M36MI, N37E, R41K, L63P, K70KT, V77I, L89X, I93L  
>CA17509| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIELPGKWKPKIVGGIGGFIKVRQYD
QIPIEICGHTAISTVLIGPTPVNIIGRNXMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75VL, K219N K103KN   K20R, T39A, E44D, V118I, K122E, I135T, D177E, H208Y, R211DN, L283I, R284K, I293V  
>CA17385| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWDWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005