<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1600 CA17508 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 260
2 AZT+DDI 47
3 None 13
4 3TC+AZT+SQV 21
5 3TC+D4T+IDV 52
6 RTV+SQV 4
7 3TC+AZT+NVP 34
8 3TC+AZT 17
9 ADV+D4T+EFV+RTV+SQV 69
10 D4T+DDI+NVP 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I54IT, V82VA   L10I, R57K, L63P, I64L, A71V, I72V, V77VI  
>CA17508| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGFTKVKQYD
QIPLEICGHKVVGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y D67G     V35M, T39A, E40F, K43E, V60VI, S68G, R83RK, W88WC, K104R, V118I, K122E, D177N, T200A, R211K, K219X, L228H, T286A, E291D, E297K, A304G  
>CA17384| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAFLEEEGKISKIGPENPYNTPI
FAIKKKGGTKWRKIVDFRELNKKTQDFCEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDXKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVIPLTKEAE
LELG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005