<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3914 CA17503 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 111
2 AZT+DDC 39
3 3TC+AZT 31
4 3TC+D4T 37
5 AZT+DDI+NFV 77
6 3TC+AZT+EFV+NFV 91

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L33I, T74P R41K, I62V, L63P, H69HY, A71T, I72V, V77I, I93L  
>CA17503| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGYKTVGPVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V D67G K103KN, Y188YFHL A98G K64R, I135IM, I142V, G196E, R211A, F214L, V245M, Q278E, I293V, E297K N136ND, T253TP
>CA17378| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMDNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIEQHRTKIEELRQHLLAWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWPVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVVPLTKE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005