<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1497 CA17491 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 152
2 AZT+ DDI 17
3 3TC+ AZT 17
4 AZT+ 3TC+ IDV 34
5 D4T+ DDI+ RTV 43
6 DDI+3TC+NVP+SQV+RTV+D4T 13
7 D4T+DDI+3TC+SQV+RTV 76
8 D4T+DDI+3TC+SQV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M Q58E, G73T L10I, I13V, K20I, M36MI, F53Y, K55R, L63P, A71V R8RQ
>CA17491| codons 5-99
LWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGYVRVREYDQIPI
EICGHKVITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y     A98G K20R, V35I, K43E, E44D, V118I, D123E, I135T, D177E, T200K, Q207E, H208Y, R211K, K223Q, E248D, A272S, K277R, Q278QH, T286TA, I293V, A304G  
>CA17357| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRKKIEELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYSGIKVRHLCKLLRGAKALTEVVPLTEEAE
LELG

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009